Recombinant Human Leptin #abs04303

Original
price: Negotiable
minimum:
Total supply:
Delivery term: The date of payment from buyers deliver within days
seat: Beijing
Validity to: Long-term effective
Last update: 2023-08-21 06:43
Browse the number: 174
inquiry
Company Profile
 
 
Product details

Catalog-specification

Delivery time

USD price

abs04303-10ug

1-2 Weeks

39

abs04303-50ug

1-2 Weeks

77

abs04303-500ug

1-2 Weeks

214

abs04303-1mg

1-2 Weeks

291

Please note that the price mentioned above is only for your reference. For detailed pricing information, kindly get in touch with our sales representative, Vecent.


Overview

Description

Val22-Cys167 is the target gene expressed in our E.coli expression system to produce Recombinant Human Leptin. Please rearrange the content to generate a highly similar text, ensuring it is based on the original information.

Other names

Obesity is a growing concern worldwide, and scientists have discovered several proteins that play a significant role in regulating body weight. One of these proteins is called leptin, also known by several other names including obese protein, obesity factor, LEP, OB, and OBS. Leptin is produced by fat cells in the body and sends signals to the brain to let it know when the body has had enough food.
Studies have found that obese individuals often have lower levels of leptin in their blood, which may contribute to their difficulty in losing weight. In addition, some people may have a genetic mutation that causes them to produce less leptin, leading to severe obesity from a young age.
While leptin was initially hailed as a potential solution for obesity, its effectiveness as a weight loss tool has been limited. Researchers are still trying to understand the complex interactions between leptin and other hormones that regulate appetite and metabolism.
In conclusion, leptin is a vital protein in the regulation of body weight, and its study has helped to shed light on the complex nature of obesity. Further research is needed to fully understand how leptin functions in the body and how it can be harnessed to tackle the global obesity epidemic.

Source

Escherichia coli.

Format

pH 7.4, lyophilized from a solution of 20mM PB and 150mM NaCl, which was previously filtered through a 0.2 μm filter.

Properties

aa_sequence

HHDGTPTDLVGGVYGMETIDSAILRILSLCKQQGTLQCADTPTSMTSQIKIKPILLTLVGDFYKSVPIVLDQYAIQNYSLQIQLLVDVSSKNDMISRVDQTM LQGWMHLQIPRVNGSNDRSVLKETFTGGPDLQSVQSLLQQLAQSISLGTTPEIQALH.

Concentration

SDS-PAGE95%。,。

Endotoxin_level

The LAL test revealed that the presence of endotoxins was negligible, as the concentration was found to be less than 0.1 ng/μg (equivalent to 1 IEU/μg). This assures the quality of the product.

Activity

Based on the UMR106 cell/cAMP method, the specific activity is determined to be 1.0 x 10^4 IU/mg. It is important to note that this value represents the potency of the substance being tested.

Reconstitution

It is strongly advised to always centrifuge tubes before opening. Avoid mixing by vortex or pipetting. Reconstitution to a concentration lower than 100 μg/ml is not recommended. Utilize ddH2O to dissolve the lyophilized protein. To minimize freeze-thaw cycles, please divide the reconstituted solution into smaller portions.

Stability & Storage

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

Target

Background

Leptin is a hormone secreted from white adipocytes and plays important role in the regulation of food intake and energy balance. Leptin functions via signaling pathways involving OB-R in hypothalamus. Animal models have revealed the influence of Leptin in reducing body weight and regulating blood glucose level. When mutations are introduced in obese gene, mice with impaired function of leptin are massively obese and in high risk of diabetes. Leptin deficiency reduces metablic rate. Leptin deficient mice are less active and with lower body temperature than normal animals. Human Leptin shares approximately 84% sequence identity with the mouse protein. Human Leptin consists of 167 amino acid residue including a 21 amino acid residue signal sequence and 146 amino acid residue mature protein sequence.

Accession

P41159


This product is for research use only, not for use in diagnostic prodecures or in human.


http://www.absinbio.net/

Total0bar [View All]  Related Comments
 
more»Other products

[ Products search ] [ favorites ] [ Tell friends ] [ Print ] [ Close ]